PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00136g00045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family TALE
Protein Properties Length: 567aa    MW: 63104.5 Da    PI: 6.4113
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00136g00045.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.7e-084935242354
                               SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               +yp+ +e++ LA k gLt +qV++WF N R +
  Peaxi162Scf00136g00045.1 493 MYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 524
                               69****************************88 PP

2BELL73.92.5e-24365432371
                      BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                               ++ ++kk +L+ ll+ Vd++Y+q+ +++++vis+F+av++l++ ++++++Al++iS  +++L+++i++ 
  Peaxi162Scf00136g00045.1 365 MDCEAKKKHLVALLQVVDDQYNQCLDEIHMVISAFHAVTELDP-RIHARFALQTISSLYKNLRERISNY 432
                               67899**************************************.**********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-19288431IPR006563POX domain
PfamPF075266.1E-27294430IPR006563POX domain
CDDcd000864.01E-10475529No hitNo description
SMARTSM003891.7E-5475532IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-18478534IPR009057Homeodomain-like
SuperFamilySSF466891.92E-11486537IPR009057Homeodomain-like
PROSITE profilePS5007110.074494528IPR001356Homeobox domain
PfamPF059202.4E-10494524IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MAEPHPFLDE NLLHTAGVPI SFSNIVGLNY QNHTMGEQNH IIDGHGIRIP FMLQGESINS  60
SQACQSLPNF PRAIETGAIP DMLPGRNRIK EFSLSTSYPI SNPYAEDQYM EGVPISAVAL  120
ANLLAARNAM LENPENLAVL APLSQSVEGQ KIDGPDYPTV LNPSFGSYRN YEFDGVPEIA  180
GTNAGRTGSQ PFQFTENVNS NTWFSSETAS LSSDSPSGSS SRFSNELSLS LTTSQSAVVC  240
GTTIQNQGSD ISCSGVTNHA FPQRRFDSEP TPCNSRNMSL NFGSNKPAHL SHFLTGSRYL  300
HVMQEILSEI AQLSFQNHNM VGYRGNGTSY GANTSFTLSP DSGRGNAALS SDDLPDGDNR  360
INAQMDCEAK KKHLVALLQV VDDQYNQCLD EIHMVISAFH AVTELDPRIH ARFALQTISS  420
LYKNLRERIS NYILAMGEQF DKGGERGGVE NSFETSFIQK QWALQQLKRK DHQLWRPQRG  480
LPERSVSVLR AWMYPKDAEK QLLAVKSGLT RSQVSNWFIN ARVRLWKPMI EEMYAEMNRR  540
KIRSGNEDEA SNRRNNKIIE NHIFAMN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361000.20.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-93ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.12e-92homeobox gene 1